Invitrogen™ Human INCA1 (aa 166-235) Control Fragment Recombinant Protein

Product Code. 30212020

Brand: Invitrogen™ RP106394

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65720 (PA5-65720. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds to CDK2-bound cyclins and inhibits the kinase activity of CDK2; binding to cyclins is critical for its function as CDK inhibitor (PubMed:21540187). Inhibits cell growth and cell proliferation and may play a role in cell cycle control. Required for ING5-mediated regulation of S-phase progression, enhancement of Fas-induced apoptosis and inhibition of cell growth. [UniProt]

Specifications

• Accession Number: Q0VD86
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 388324
• Name: Human INCA1 (aa 166-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI842396; HSD45; INCA1; Inhibitor of CDK interacting with cyclin A1; inhibitor of CDK, cyclin A1 interacting protein 1; protein INCA1; RGD1306656
• Common Name: INCA1
• Gene Symbol: INCA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining