Invitrogen™ Human Importin 11 (aa 349-422) Control Fragment Recombinant Protein

Product Code. 30211263

Brand: Invitrogen™ RP109085

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IPO11 functions in nuclear protein import as nuclear transport receptor. It serves as receptor for nuclear localization signals (NLS) in cargo substrates and is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP-and GDP-bound forms of Ran between the cytoplasm and nucleus. It mediates the nuclear import of UBE2E3, and of RPL12.

Specifications

• Accession Number: Q9UI26
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51194
• Name: Human Importin 11 (aa 349-422) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700081H05Rik; 2510001A17Rik; AI314624; AW555235; E330021B14Rik; Imp11; importin 11; importin-11; IPO11; Ran binding protein 11; ran-binding protein 11; Ranbp11
• Common Name: Importin 11
• Gene Symbol: IPO11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEYNQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining