Invitrogen™ Human IMMP1L (aa 31-84) Control Fragment Recombinant Protein

Product Code. 30210965

Brand: Invitrogen™ RP108428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84373 (PA5-84373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex.

Specifications

• Accession Number: Q96LU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 196294
• Name: Human IMMP1L (aa 31-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500034J20Rik; 2610528O17Rik; AU042386; IMMP1; Immp1l; IMP1; IMP1 inner mitochondrial membrane peptidase-like; IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP1-LIKE; IMP1-like protein; inner mitochondrial membrane peptidase subunit 1; mitochondrial inner membrane protease subunit 1
• Common Name: IMMP1L
• Gene Symbol: IMMP1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining