Invitrogen™ Human ILVBL (aa 145-241) Control Fragment Recombinant Protein

Product Code. 30198717

Brand: Invitrogen™ RP103693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64335 (PA5-64335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene shares similarity with several thiamine pyrophosphate-binding proteins identified in bacteria, yeast, and plants. The highest degree of similarity is found with bacterial acetolactate synthases (AHAS), which are enzymes that catalyze the first step in branched-chain amino acid biosynthesis.

Specifications

• Accession Number: A1L0T0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10994
• Name: Human ILVBL (aa 145-241) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 209L8; 2-hydroxyacyl-CoA lyase 1 like; 2-hydroxyacyl-CoA lyase 2; acetolactate synthase-like protein; 5830463I21; acetolactate synthase homolog; acetolactate synthase-like protein; AHAS; AI415009; HACL1L; ILV2H; ilvB (bacterial acetolactate synthase)-like; ilvB acetolactate synthase like; ILVBL; ilvB-like protein
• Common Name: ILVBL
• Gene Symbol: ILVBL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining