Invitrogen™ Human IL9R (aa 57-143) Control Fragment Recombinant Protein

Product Code. 30194098

Brand: Invitrogen™ RP108487

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84592 (PA5-84592. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human Interleukin 9 (IL9) was first identified based on its proliferative activity on a human myeloid leukemic cell line. Human IL9 stimulates the proliferation of the human megakaryocytic leukemic cell line M07e. Human IL9 supports erythroid colony formation and synergizes with IL4 in the production of IgE and IgG. The interleukin 9 receptor is a member of the hematopoietin receptor superfamily. The cDNAs encoding mouse and human IL9 receptors have been isolated. The deduced mouse and human transmembrane proteins, sharing 53% amino acid sequence identity, contain 468 and 533 amino acid residues, respectively. A number of isoforms of IL9R, including a putative soluble form, have also been identified. The IL9 receptor is expressed in a variety of hematopoietic cells including T cells, neutrophils, mast cells, and macrophages.

Specifications

• Accession Number: Q01113
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3581
• Name: Human IL9R (aa 57-143) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD129; IL-9 receptor; Il9r; IL-9 R; interleukin 9 receptor; interleukin-9 receptor
• Common Name: IL9R
• Gene Symbol: IL9R
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining