missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IL4R (aa 480-579) Control Fragment Recombinant Protein

Product Code. 30208135
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208135 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208135 Supplier Invitrogen™ Supplier No. RP109204

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL4 Receptor alpha (IL4RA) is the alpha chain of the interleukin 4 receptor which binds to both interleukin 4 and interleukin 13 to regulate IgE production, chemokine and mucus production at sites of allergic inflammmation. The IL4 response is involved in promoting Th2 differentiation. The secreted extracellular domain of IL4R alpha, called sIL4R alpha, can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. It has no signaling abilities. Allelic variations in the IL4RA gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P24394
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3566
Name Human IL4R (aa 480-579) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 582J2.1; CD124; il-4 receptor; IL-4 receptor alpha chain; IL-4 receptor subunit alpha; IL-4-binding protein; IL4-BP; Il4r; IL4R nirs variant 1; IL-4 R subunit alpha; IL4RA; IL-4 RA; IL-4 R-alpha; interleukin 4 receptor; interleukin 4 receptor, alpha; interleukin-4 receptor alpha chain; interleukin-4 receptor subunit alpha; Soluble IL-4 receptor subunit alpha; Soluble interleukin-4 receptor subunit alpha
Common Name IL4R
Gene Symbol IL4R
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.