missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207791

Invitrogen™ Human IL36B (aa 9-82) Control Fragment Recombinant Protein

Product Code. 30207791
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207791

Brand: Invitrogen™ RP96089

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57358 (PA5-57358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL-36B is is a member of the interleukin 1 cytokine family whose gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. IL-36B is thought to activate the NF-kappaB pathway through IL-1 receptor family members IL-1RL2 and IL-1RAcP. Like the related proteins IL-36A and IL-36G, IL-36B requires post-translational processing for full agonist activity, but the cleavage mechanism is currently unknown. The IL-36 cytokines have been suggested to amplify Th1 responses by enhancing proliferation and Th1 polarization of naive CD4+ T cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZH7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27177
Name Human IL36B (aa 9-82) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310043N20Rik; family of interleukin 1-eta; FIL1; FIL1 eta; FIL1-(ETA); Fil1e; FIL1H; FILI-(ETA); IL-1 eta; IL1-ETA; IL1F8; IL-1F8; IL1F8 (Canonical product IL-1F8a); IL-1F8 (FIL1-eta); IL1H2; IL-1H2; Il36b; Interleukin; interleukin 1 family, member 8; interleukin 1 family, member 8 (eta); interleukin 1, eta; interleukin 36, beta; interleukin-1 eta; Interleukin-1 family member 8; interleukin-1 homolog 2; Interleukin-1 Superfamily e; interleukin-36 beta
Common Name IL36B
Gene Symbol IL36B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.