missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16281930

Abnova™ Human IL1RN (P18510, 26 a.a. - 177 a.a.) Partial Recombinant Protein

Product Code. 16281930
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16281930 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16281930 Supplier Abnova™ Supplier No. P3628.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Specifications

Accession Number P18510
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 3557
Molecular Weight (g/mol) 17kDa
Name IL1RN (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 100 μg
Immunogen RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias ICIL-1RA/IL-1ra3/IL1F3/IL1RA/IRAP/MGC10430
Common Name IL1RN
Gene Symbol IL1RN
Biological Activity The ED50 was determined by the ability to inhibit the IL-1alpha mediated cell proliferation in a murine helper T cell line,for this effect, in the presence of 50pg/mL of IL-1alpha, is typically 20 - 60ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.