Invitrogen™ Human IL1F9 (aa 134-169) Control Fragment Recombinant Protein

Product Code. 30194196

Brand: Invitrogen™ RP110062

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144950 (PA5-144950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.

Specifications

• Accession Number: Q9NZH8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56300
• Name: Human IL1F9 (aa 134-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: IL-1 epsilon; IL-1 related protein 2; IL-1(EPSILON); IL1E; IL-1-epsilon; IL1F9; IL-1F9; IL1H1; IL-1H1; IL-1-related protein 2; IL1RP2; IL-1 RP2; IL36G; Interleukin; interleukin 1 family, member 9; interleukin 1-related protein 2; interleukin 36, gamma; interleukin-1 epsilon; Interleukin-1 family member 9; interleukin-1 homolog 1; Interleukin-36; Interleukin-36 gamma; UNQ2456/PRO5737
• Common Name: IL1F9
• Gene Symbol: IL36G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining