Invitrogen™ Human IL18BP (aa 113-194) Control Fragment Recombinant Protein

Product Code. 30211492

Brand: Invitrogen™ RP102904

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59412 (PA5-59412. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interleukin-18 binding protein (IL-18BP) is a constitutively secreted glycoprotein that acts as a natural antagonist for interleukin-18 (IL-18) by preventing interaction between IL-18 and its receptors. Through this binding, IL-18BP neutralizes the proinflammatory role of IL-18 in cell-mediated immune responses, resulting in reduced IFN-gamma production by T helper type I cells and inhibition of allospecific cytotoxic T lymphocyte (CTL) activity through augmented natural killer (NK) cell cytotoxicity. As an inhibitor of IL-18 and an essential component of skin homeostasis, IL-18BP has been linked to a variety of diseases, including eczema, asthma, and the autoimmune condition, Crohn's disease. The upregulation of IL-18BP by keratinocytes expressing the human papillomavirus (HPV) E7 oncoprotein has been shown to decrease IL-18-induced IFN-gamma production and IL-18-mediated T cell activation. Elevated levels of IL-18 and IL-18BP, as well as proinflammatory cytokines IFN-gamma, TNF-alpha, IL-1beta and IL-8, have been linked to chronic inflammation and observed in macrophages (including Kupffer cells) isolated from lesions and intestinal tissues of Crohn's disease patients. As a member of the immunoglobulin-like class of receptors, IL-18BP contains a single immunoglobulin (Ig) domain; although two (b and d) of the four identified human isoforms (a-d) contain incomplete domains that greatly reduce their binding affinity.

Specifications

• Accession Number: O95998
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10068
• Name: Human IL18BP (aa 113-194) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Igifbp; Il18bp; IL-18 BP; IL18BPa; interferon gamma inducing factor binding protein; interferon gamma-inducing factor-binding protein; interleukin 18 binding protein; interleukin-18 binding protein; interleukin-18-binding protein; MC51L-53 L-54 L homolog gene product; MC54L; Tadekinig-alfa
• Common Name: IL18BP
• Gene Symbol: IL18BP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining