Invitrogen™ Human IL17RC (aa 113-258) Control Fragment Recombinant Protein

Product Code. 30194902

Brand: Invitrogen™ RP90444

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54108 (PA5-54108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a single-pass type I membrane protein that shares similarity with the interleukin-17 receptor (IL-17RA). Unlike IL-17RA, which is predominantly expressed in hemopoietic cells, and binds with high affinity to only IL-17A, this protein is expressed in nonhemopoietic tissues, and binds both IL-17A and IL-17F with similar affinities. The proinflammatory cytokines, IL-17A and IL-17F, have been implicated in the progression of inflammatory and autoimmune diseases. Multiple alternatively spliced transcript variants encoding different isoforms have been detected for this gene, and it has been proposed that soluble, secreted proteins lacking transmembrane and intracellular domains may function as extracellular antagonists to cytokine signaling.

Specifications

• Accession Number: Q8NAC3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84818
• Name: Human IL17RC (aa 113-258) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110025H02Rik; CANDF9; Gm19850; IL-17 receptor C; IL17F receptor; IL17RC; IL-17 RC; IL17-RC; IL17Rhom; Il17rl; IL-17 RL; IL17-RL; interleukin 17 receptor C; interleukin-17 receptor C; Interleukin-17 receptor homolog; interleukin-17 receptor-like protein; UNQ6118/PRO20040/PRO38901; ZcytoR14
• Common Name: IL17RC
• Gene Symbol: IL17RC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining