Invitrogen™ Human IL13RA1 (aa 30-152) Control Fragment Recombinant Protein

Product Code. 30201748

Brand: Invitrogen™ RP91957

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81870 (PA5-81870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.

Specifications

• Accession Number: P78552
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3597
• Name: Human IL13RA1 (aa 30-152) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI882074; Cancer/testis antigen 19; CD antigen CD213a1; CD213a1; CD213a1 antigen; CT19; IL13 receptor alpha-1 chain; IL-13 receptor subunit alpha-1; IL13R; IL-13 R subunit alpha-1; IL-13 r[a]; IL13RA; IL-13 Ra; IL13RA1; IL-13 RA1; IL-13 R-alpha-1; interleukin 13 receptor subunit alpha 1; interleukin 13 receptor, alpha 1; interleukin 13 receptor, alpha 1-like; interleukin-13 receptor subunit alpha-1; Interleukin-13-binding protein; LOC100360218; Novel cytokine receptor 4; NR4
• Common Name: IL13RA1
• Gene Symbol: IL13RA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining