Invitrogen™ Human IL12RB1 (aa 26-117) Control Fragment Recombinant Protein

Product Code. 30206062

Brand: Invitrogen™ RP107995

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67345 (PA5-67345. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukin 12 with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The lack of expression of this gene was found to result in the immunodeficiency of patients with severe mycobacterial and Salmonella infections. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Specifications

• Accession Number: P42701
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3594
• Name: Human IL12RB1 (aa 26-117) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD212; cluster of differentiation 212; IL-12 receptor beta component; IL-12 receptor subunit beta-1; IL12R; IL-12 R subunit beta-1; IL-12 R[b]; IL12RB; Il12rb1; IL-12 RB1; IL-12 R-BETA1; IL-12 R-beta-1; IMD30; interleukin 12 receptor subunit beta 1; interleukin 12 receptor, beta 1; interleukin-12 receptor beta-1 chain; Interleukin-12 receptor beta-1 chain precursor (IL-12 R-beta1) (Interleukin-12 receptor beta) (IL-12 receptor beta component); interleukin-12 receptor subunit beta-1; MGC34454
• Common Name: IL12RB1
• Gene Symbol: IL12RB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining