missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IL10RA (aa 22-83) Control Fragment Recombinant Protein

Product Code. 30211519
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211519

Brand: Invitrogen™ RP109176

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13651
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3587
Name Human IL10RA (aa 22-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW553859; CD210; CD210a; CDw210; CDW210A; CDW210B; CRF2-4; CRFB4; D21S58; D21S66; HIL-10 R; I10R; I10R1; il-10 receptor; il-10 receptor antagonist; IL-10 receptor subunit alpha; IL10R; IL-10 R alpha; IL-10 R subunit 1; IL-10 R subunit alpha; IL-10R1; IL-10R2; Il10ra; IL-10 RA; interleukin 10 receptor subunit alpha; interleukin 10 receptor, alpha; interleukin-10 receptor alpha chain; interleukin-10 receptor subunit 1; Interleukin-10 receptor subunit alpha; mIL-10 R
Common Name IL10RA
Gene Symbol Il10ra
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.