Invitrogen™ Human IL-8 (CXCL8) (aa 28-92) Control Fragment Recombinant Protein

Product Code. 30206424

Brand: Invitrogen™ RP95139

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interleukin 8 (IL-8, CXCL8) is a 72 amino acid pro-inflammatory factor which belongs to the CXC subfamily of chemokines, and are bound by the cell surface receptors IL-8RA and IL-8RB. IL-8 functions as a chemoattractant and potent angiogenic factor. The expression and secretion of IL-8 can be induced by diverse inflammatory stimuli in many cells, including macrophages and endothelial cells. In endothelial cells, IL-8 is present in storage vesicles called Weibel-Palade bodies. IL-8, first isolated from osteosarcoma cells, contains the ELR-motif (N-terminal Glu-Leu-Arg amino acid sequence) and signals through the CXCR1 and CXCR2 receptors. Previous nomenclature for IL-8 includes neutrophil activating protein 1 (NAP-1), granulocyte chemotactic protein 1 (GCP-1), monocyte-derived neutrophil-activating peptide (MONAP) and protein 3-10C. IL-8 and ten other members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. Cancer studies have demonstrated a role for IL-8 in the angiogenesis and growth of tumours, and IL-8 is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.

Specifications

• Accession Number: P10145
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3576
• Name: Human IL-8 (CXCL8) (aa 28-92) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (Ala-IL-8)77; (Ser-IL-8)72; Alveolar macrophage chemotactic factor I; alveolar macrophage-derived chemotactic factor-I; AMCF-I; AN x 7; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; C-X-C motif chemokine 8; C-X-C motif chemokine ligand 8; CXCL8; cytokine 8; emoctakin; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; GCP-1; Granulocyte chemotactic protein 1; IL8; IL-8; IL-8(1-77); IL-8(5-77); IL-8(6-77); IL-8(7-77); IL-8(8-77); IL-8(9-77); IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; ILN; Interleukin; interleukin 8; Interleukin8; interleukin-8; interleuklin-8 precursor; LECT; LUCT; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-a; MDNCF-b; MDNCF-c; MONAP; Monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; NAF; NAP1; NAP-1; neutrophil activating peptide 1; neutrophil and T-lymphocyte chemotactic and activating factor; Neutrophil attractant/activation protein 1; neutrophil attractant/activation protein-1; Neutrophil-activating factor; neutrophil-activating peptide 1; Neutrophil-activating protein 1; Permeability factor 1; PF1; Protein 3-10 C; RP11-537A6.8; RPF1; small inducible cytokine subfamily B, member 8; SNX; SYNEXIN; T-cell chemotactic factor; tumor necrosis factor-induced gene 1
• Common Name: IL-8
• Gene Symbol: CXCL8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining