missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210149

Invitrogen™ Human IL-18 (aa 1-151) Control Fragment Recombinant Protein

Product Code. 30210149
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210149

Brand: Invitrogen™ RP102266

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110679 (PA5-110679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein can specifically interact with this cytokine, and thus negatively regulate its biological activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14116
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3606
Name Human IL-18 (aa 1-151) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cytokine; iboctadekin; IFN-gamma-inducing factor; IGIF; il 18; IL-1 gamma; IL18; IL-18; IL1F4; IL-1 g; ILN; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; Interleukin; interleukin 18; interleukin 18 (interferon-gamma-inducing factor); interleukin-1 gamma; Interleukin18; Interleukin-18; interleukin-18 proprotein; interleukin-18-like protein; MGC12320
Common Name IL-18
Gene Symbol IL18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.