Invitrogen™ Human IKBIP (aa 280-359) Control Fragment Recombinant Protein

Product Code. 30207933

Brand: Invitrogen™ RP105194

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66401 (PA5-66401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IKIP (Inhibitor of nuclear factor kappa-B kinase-interacting protein, IKK-interacting protein) is a single-pass membrane protein that shares a common promoter with APAF1. APAF1 and IKIP are both induced by X irradiation, however, the two gene products are transcribed in different directions. The IKIP gene is believed to be a target for p53 as expression of IKIP has been shown to promote apoptosis. IKIP has four known isoforms, three of which are found traversing the endoplasmic reticulum membrane. IKIP isoform 4 has a deletion of the transmembrane region which leads to a homogenous distribution of the protein within the cell. The IKIP gene products are expressed in vascular endothelial cells, while the isoform 4 has also been detected in lung, kidney, spleen, thymus and skeletal muscle.

Specifications

• Accession Number: Q70UQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 121457
• Name: Human IKBIP (aa 280-359) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200009F10Rik; 1700023M03Rik; D18354; I kappa B kinase interacting protein; i kappa-B kinase interacting protein; i kappa-B kinase-interacting protein; Ikbip; IKBKB interacting protein; IKBKB-interacting protein; Ikip; IKK interacting protein; IKK-interacting protein; inhibitor of nuclear factor kappa-B kinase-interacting protein
• Common Name: IKBIP
• Gene Symbol: IKBIP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQYDNSILKMQNELDILKEKVHDFIAYSSTGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining