missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IKBIP (aa 280-359) Control Fragment Recombinant Protein

Product Code. 30207933
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207933

Brand: Invitrogen™ RP105194

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66401 (PA5-66401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IKIP (Inhibitor of nuclear factor kappa-B kinase-interacting protein, IKK-interacting protein) is a single-pass membrane protein that shares a common promoter with APAF1. APAF1 and IKIP are both induced by X irradiation, however, the two gene products are transcribed in different directions. The IKIP gene is believed to be a target for p53 as expression of IKIP has been shown to promote apoptosis. IKIP has four known isoforms, three of which are found traversing the endoplasmic reticulum membrane. IKIP isoform 4 has a deletion of the transmembrane region which leads to a homogenous distribution of the protein within the cell. The IKIP gene products are expressed in vascular endothelial cells, while the isoform 4 has also been detected in lung, kidney, spleen, thymus and skeletal muscle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q70UQ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 121457
Name Human IKBIP (aa 280-359) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200009F10Rik; 1700023M03Rik; D18354; I kappa B kinase interacting protein; i kappa-B kinase interacting protein; i kappa-B kinase-interacting protein; Ikbip; IKBKB interacting protein; IKBKB-interacting protein; Ikip; IKK interacting protein; IKK-interacting protein; inhibitor of nuclear factor kappa-B kinase-interacting protein
Common Name IKBIP
Gene Symbol IKBIP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQYDNSILKMQNELDILKEKVHDFIAYSSTGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.