Invitrogen™ Human IkB zeta (aa 269-357) Control Fragment Recombinant Protein

Product Code. 30204808

Brand: Invitrogen™ RP108043

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67382 (PA5-67382. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

I-kappa-B-zeta (also known as MAIL and INAP) is an ankyrin-repeat-containing nuclear protein that is highly homologous to the IkappaB family member Bcl-3. Transcription of IkappaBzeta is upregulated by stimulation with TLR ligands, IL-1 and IL-6 in cultured B-lymphocytes and monocytes/macrophages, but only faintly so in T-lymphocytes, fibroblasts, and endothelial cells. IkappaB-zeta preferentially associates with the NF-kappaB subunit p50 rather than p65 and recombinant IkappaB-zeta proteins inhibit the DNA binding of the p65/p50 heterodimer and the p50/p50 homodimer.

Specifications

• Accession Number: Q9BYH8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64332
• Name: Human IkB zeta (aa 269-357) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA408868; FLJ30225; FLJ34463; Ikappa B-zeta variant 3; ikappaBzeta; I-kappa-B-zeta; IkappaB-zeta; IKBZ; ikB-zeta; IL-1 inducible nuclear ankyrin-repeat protein; INAP; Mail; molecule possessing ankyrin repeats induced by lipopolysaccharide; molecule possessing ankyrin-repeats induced by lipopolysaccharide; NF-kappa-B inhibitor zeta; NFKB inhibitor zeta; NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; OTTHUMP00000214340; RGD1310834
• Common Name: IkB zeta
• Gene Symbol: NFKBIZ
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CQPFQVRGSQQMIDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining