missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209204

Invitrogen™ Human IKAROS (aa 402-464) Control Fragment Recombinant Protein

Product Code. 30209204
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209204

Brand: Invitrogen™ RP102656

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111054 (PA5-111054. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-binding protein IKAROS functions in the specification and the maturation of the T lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyl transferase promoter as well as with the promoters for other genes expressed during early stages of B-cell and T-cell development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13422
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10320
Name Human IKAROS (aa 402-464) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5832432G11Rik; CLL-associated antigen KW-6; CVID13; DNA-binding protein Ikaros; hIk-1; hlk-1; Hs0.5445; IK1; IKAROS; IKAROS family zinc finger 1; IKAROS family zinc finger 1 (Ikaros); ikaros family zinc finger protein 1; IKZF1; KAROS family zinc finger 1 (Ikaros); LYF1; LyF-1; Lymphoid transcription factor LyF-1; mKIAA4227; PPP1R92; PRO0758; protein phosphatase 1, regulatory subunit 92; RGD1562979; Zfpn1a1; zinc finger containing transcription factor; zinc finger protein, subfamily 1 A, 1 (Ikaros); Znfn1a1
Common Name IKAROS
Gene Symbol IKZF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.