Invitrogen™ Human IGSF10 (aa 456-601) Control Fragment Recombinant Protein

Product Code. 30195391

Brand: Invitrogen™ RP90363

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-140047 (PA5-140047, PA5-53009 (PA5-53009. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ig (immunoglobulin) superfamily members exhibit functional characteristics including immune responses, growth factor signaling and cell adhesion. IGSF10 (immunoglobulin superfamily, member 10), also known as Calvaria mechanical force protein 608 (CMF608), is a 2,623 amino acid secreted protein that contains an N-terminal signal peptide, six leucine-rich repeats (LRRs), and 12 immunoglobulin-like repeats. IGSF10 exists as multiple alternatively spliced isoforms, and is expressed in bone. Specifically, expression of IGSF10 is limited to mesenchymal osteochondroprogenitors with fibroblast-like morphology, where it is thought to be involved in the maintenance of the osteochondroprogenitor cells pool and its down-regulation precedes terminal differentiation.

Specifications

• Accession Number: Q6WRI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285313
• Name: Human IGSF10 (aa 456-601) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Calvaria mechanical force protein 608; CMF608; IgSF10; Immunoglobulin superfamily member 10; immunoglobulin superfamily, member 10
• Common Name: IGSF10
• Gene Symbol: IGSF10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQITLPRAEMRPVKHKWTMISRDNNTKLEHTVLVGGTVGLNCPGQGDPTPHVDWLLADGSKVRAPYVSEDGRILIDKSGKLELQMADSFDTGVYHCISSNYDDADILTYRITVVEPLVEAYQENGIHHTVFIGETLDLPCHSTGIP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining