Invitrogen™ Human IGHMBP2 (aa 583-658) Control Fragment Recombinant Protein

Product Code. 30197286

Brand: Invitrogen™ RP107037

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66357 (PA5-66357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Acts as a transcription regulator. Required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Binds to the insulin II gene RIPE3B enhancer region. May be involved in translation. DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region. Preferentially binds to the 5'-GGGCT-3' motif. Interacts with tRNA-Tyr. Stimulates the transcription of the human neurotropic virus JCV.

Specifications

• Accession Number: P38935
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3508
• Name: Human IGHMBP2 (aa 583-658) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AEP; antifreeze enhancer-binding protein; antifreeze enhancer-binding protein ortholog; ATP-dependent helicase IGHMBP2; cardiac transcription factor 1; CATF1; CMT2S; DNA-binding protein SMUBP-2; GF-1; Glial factor 1; HCSA; HMN6; Ighmbp2; immunoglobulin mu binding protein 2; immunoglobulin mu DNA binding protein 2; immunoglobulin mu-binding protein 2; immunoglobulin S mu binding protein 2; neuromuscular degeneration; nmd; p110 subunit; RIPE3b1; sma; SMARD1; Smbp2; Smbp-2; SMUBP2; ZFAND7; zinc finger, AN1-type domain 7
• Common Name: IGHMBP2
• Gene Symbol: IGHMBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining