Invitrogen™ Human IGFL1 (aa 31-102) Control Fragment Recombinant Protein

Product Code. 30196154

Brand: Invitrogen™ RP90577

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53109 (PA5-53109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IGFL1 belongs to the insulin-like growth factor family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth.

Specifications

• Accession Number: Q6UW32
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 374918
• Name: Human IGFL1 (aa 31-102) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: APRG644; IGF; IGF like family member 1; IGFL1; IGF-like family member 1; Insulin growth factor-like family member 1; Insulin like growth factor; UNQ644; UNQ644/PRO1274
• Common Name: IGFL1
• Gene Symbol: IGFL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining