Invitrogen™ Human IGFBP-1 (aa 161-253) Control Fragment Recombinant Protein

Product Code. 30180923

Brand: Invitrogen™ RP98488

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62226 (PA5-62226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Specifications

• Accession Number: P08833
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3484
• Name: Human IGFBP-1 (aa 161-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AFBP; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; hIGFBP 1; hIGFBP1; hIGFBP-1; IBP 1; IBP1; IBP-1; IGF BP25; IGFBA; IGF-binding protein 1; IGFBP; IGFBP 1; Igfbp1; Igfbp-1; IGF-BP25; Insulin like growth factor binding protein; insulin like growth factor binding protein 1; insulin-like growth factor binding protein 1; INSULIN-LIKE GROWTH FACTOR BINDING PROTEIN 1 PRECURSOR (IGFBP-1) (IBP-1) (IGF-BINDING PROTEIN 1); insulin-like growth factor-binding protein 1; Placental protein 12; PP 12; PP12
• Common Name: IGFBP-1
• Gene Symbol: IGFBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining