Invitrogen™ Human IFT46 (aa 44-133) Control Fragment Recombinant Protein

Product Code. 30196181

Brand: Invitrogen™ RP97312

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58162 (PA5-58162. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forms part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. May play a role in chondrocyte maturation and skeletogenesis.

Specifications

• Accession Number: Q9NQC8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56912
• Name: Human IFT46 (aa 44-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500035H01Rik; AA408110; AI663846; c11orf2; C11orf60; CFAP32; cilia and flagella associated protein 32; Ift46; intraflagellar transport 46; intraflagellar transport 46 homolog; intraflagellar transport protein 46 homolog; intraflagellar transport protein IFT46; R75047; UPF0360
• Common Name: IFT46
• Gene Symbol: IFT46
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining