Invitrogen™ Human IFT122 (aa 751-835) Control Fragment Recombinant Protein

Codice prodotto. 30198007

Marca: Invitrogen™ RP96421

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59742 (PA5-59742. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifica

• Accession Number: Q9HBG6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55764
• Name: Human IFT122 (aa 751-835) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C86139; CED; CED1; hypothetical protein zgc:77217; Ift122; intraflagellar transport 122; intraflagellar transport 122 homolog; intraflagellar transport 122 homolog (Chlamydomonas); intraflagellar transport protein 122 homolog; sopb; SPG; WD repeat domain 10; WD repeat-containing protein 10; WD repeat-containing protein 140; WDR10; WDR10p; WDR140; zgc:77217
• Common Name: IFT122
• Gene Symbol: IFT122
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining