Invitrogen™ Human IFRD1 (aa 328-413) Control Fragment Recombinant Protein

Product Code. 30196413

Brand: Invitrogen™ RP92274

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54985 (PA5-54985. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tis7, also known as IFRD1, is a 442 amino acid containing membrane associated, non-nuclear intracellular protein belonging to the IFRD family. A regulatory protein expressed in a variety of tissues, Tis7 is known to play an important role in the regulation of gene activity in the proliferative and/or differentiative pathways induced by NGF. Reports suggest that Tis7 may be an autocrine factor that attenuates or amplifies the initial ligand induced signal and might also augment the adaptive response by stimulating the production of differentiated enterocytes. Tis7 acts as a negative regulator of transcriptional activity and represses expression of genes involved in myogenesis, muscle maintenance, and regeneration in a histone deacetylase dependent manner.

Specifications

• Accession Number: O00458
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3475
• Name: Human IFRD1 (aa 328-413) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12-O-tetradecanoylphorbol-13-acetate-induced sequence 7; hypothetical protein LOC541283; Ifnl; Ifrd1; interferon related developmental regulator 1; interferon-related developmental regulator 1; IRPR; nerve growth factor-inducible protein PC4; Pc4; pheochromocytoma cell-4; Tis7; TIS7 protein; TPA induced sequence 7; TPA-induced sequence 7
• Common Name: IFRD1
• Gene Symbol: IFRD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKVDKRKQRSVFRDVLRAVEERDFPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining