Invitrogen™ Human IFNLR1 (aa 121-226) Control Fragment Recombinant Protein

Product Code. 30203941

Brand: Invitrogen™ RP90552

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53583 (PA5-53583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: Q8IU57
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 163702
• Name: Human IFNLR1 (aa 121-226) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: class II cytokine receptor 12; class II cytokine receptor CRF2/12; CRF2/12; CRF2-12; Cytokine receptor class-II member 12; cytokine receptor family 2 member 12; IFN-lambda R1; IFN-lambda receptor 1; IFN-lambda-R1; IFNLR; IFNLR1; IL-28 receptor subunit alpha; IL-28R1; Il28ra; IL-28 RA; IL-28 R-alpha; Interferon lambda receptor 1; interferon lambda, receptor 1; interferon, lambda receptor 1; interferon-lambda receptor 1; interleukin 28 alpha receptor; interleukin 28 receptor A; interleukin 28 receptor alpha; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin or cytokine receptor 2; Interleukin-28; interleukin-28 receptor subunit alpha; LICR2; Likely interleukin or cytokine receptor 2; RGD1562689
• Common Name: IFNLR1
• Gene Symbol: Ifnlr1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining