Invitrogen™ Human IDUA (aa 149-251) Control Fragment Recombinant Protein

Product Code. 30194789

Brand: Invitrogen™ RP104298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83850 (PA5-83850. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IDUA encodes an enzyme that hydrolyzes the terminal alpha-L-iduronic acid residues of two glycosaminoglycans, dermatan sulfate and heparan sulfate. This hydrolysis is required for the lysosomal degradation of these glycosaminoglycans.

Specifications

• Accession Number: P35475
• Concentration: 1.70 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3425
• Name: Human IDUA (aa 149-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030426D08; Alpha-L-iduronidase; IDA; IDUA; iduronidase alpha-L-; iduronidase, alpha-L-; MPS1
• Common Name: IDUA
• Gene Symbol: IDUA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining