Invitrogen™ Human IDH3B (aa 67-157) Control Fragment Recombinant Protein

Product Code. 30182579

Brand: Invitrogen™ RP99328

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61951 (PA5-61951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

• Accession Number: O43837
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3420
• Name: Human IDH3B (aa 67-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C78231; DH3B; H-IDHB; H-IDHG; IDH3B; Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; isocitrate dehydrogenase 3 (NAD(+)) beta; isocitrate dehydrogenase 3 (NAD+) beta; isocitrate dehydrogenase 3 beta; isocitric dehydrogenase subunit beta; N14A tumor-related protein; NAD(+)-specific ICDH subunit beta; NAD+-specific isocitrate dehydrogenase b subunit; RP46
• Common Name: IDH3B
• Gene Symbol: Idh3b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining