missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IDH1 (aa 144-208) Control Fragment Recombinant Protein

Product Code. 30207739
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207739

Brand: Invitrogen™ RP96103

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75874
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3417
Name Human IDH1 (aa 144-208) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI314845; AI788952; cb876; corneal epithelial crystallin; cytosolic NADP+-dependent isocitrate dehydrogenase; cytosolic NADP-isocitrate dehydrogenase; cytosolic NADP-isocitrate dehydrongenase; E030024J03Rik; epididymis luminal protein 216; epididymis secretory protein Li 26; fm90e09; HEL-216; HEL-S-26; ICDH; Id-1; IDCD; IDH; Idh1; Idh-1; IDP; Idpc; im:7143416; isocitrate dehydrogenase (NAD(+)) IDH1; isocitrate dehydrogenase (NADP(+)) 1; isocitrate dehydrogenase (NADP(+)) 1, cytosolic; Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial; Isocitrate dehydrogenase [NADP] cytoplasmic; isocitrate dehydrogenase 1 (NADP+); isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate dehydrogenase 1, soluble; Isocitric dehydrogenase; N2690; NAD(+)-specific ICDH; NADP(+)-specific ICDH; NADP+-specific ICDH; NADP-cICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; OTTHUMP00000206464; OTTHUMP00000206465; OTTHUMP00000206466; oxalosuccinate decarboxylase; PICD; wu:fm90e09; YNL037C
Common Name IDH1
Gene Symbol IDH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.