missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199235

Invitrogen™ Human ICK (aa 425-544) Control Fragment Recombinant Protein

Product Code. 30199235
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199235

Brand: Invitrogen™ RP108302

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81893 (PA5-81893. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ICK or intestinal cell kinase belongs to a very extensive family of proteins that share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. ICK encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. ICK localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. ICK purified from transfected human embryonic kidney cells undergoes autophosphorylation and phosphorylates a test protein. ICK plays a key role in development of central nervous, skeletal, and endocrine systems.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UPZ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22858
Name Human ICK (aa 425-544) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210420N10Rik; AI848300; ciliogenesis associated kinase 1; CILK1; ECO; heart serine-threonine protein kinase; hICK; iciliogenesis associated kinase 1; ICK; intestinal cell (MAK-like) kinase; intestinal cell kinase; KIAA0936; Laryngeal cancer kinase 2; LCK2; MAK-related kinase; mICK; MRK; serine/threonine protein kinase; serine/threonine-protein kinase ICK
Common Name ICK
Gene Symbol CILK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.