Invitrogen™ Human IA-6 (aa 443-534) Control Fragment Recombinant Protein

Product Code. 30206378

Brand: Invitrogen™ RP100071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60857 (PA5-60857. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IA-6, also known as insulinoma-associated 2 or INSM2, is related to IA-1 (INSM1), a zinc-finger factor that is expressed in the developing nervous system. While the exact function of IA-6 is not known, other related insulinoma-associated proteins such as IA-2 are major autoantigens in type 1 diabetes. The homology exhibited by IA-6 to IA-1 has led to speculation that IA-6 may also play a role in the regulation of gene transcription.

Specifications

• Accession Number: Q96T92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84684
• Name: Human IA-6 (aa 443-534) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: IA6; IA-6; INSM transcriptional repressor 2; Insm2; INSM2 variant 1; insulinoma-associated 2; insulinoma-associated protein 2; insulinoma-associated protein IA-6; methylated in liver tumor 1; mlt 1; mlt1; Nbla106; Zinc finger protein IA-6
• Common Name: IA-6
• Gene Symbol: INSM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KHLSTHEAGSARALAPGFGSERGAPLAFACPLCGAHFPTADIREKHRLWHAVREELLLPALAGAPPETSGPSGPSDGSAQQIFSCKHCPSTF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining