Invitrogen™ Human HTRA4 (aa 351-409) Control Fragment Recombinant Protein

Product Code. 30204471

Brand: Invitrogen™ RP93896

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60992 (PA5-60992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serine protease.

Specifications

• Accession Number: P83105
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 203100
• Name: Human HTRA4 (aa 351-409) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B430206E18Rik; High-temperature requirement factor A4; HtrA serine peptidase 4; HTRA4; probable serine protease HTRA4; RGD1306242; serine protease HTR4; Serine protease HTRA4
• Common Name: HTRA4
• Gene Symbol: HTRA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining