Invitrogen™ Human HTR4 (aa 319-387) Control Fragment Recombinant Protein

Artikelnummer. 30196738

Marke: Invitrogen™ RP95315

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined.

Spezifikation

• Accession Number: Q13639
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3360
• Name: Human HTR4 (aa 319-387) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5 hydroxytryptamine (serotonin) receptor 4; 5 hydroxytryptamine (serotonin) receptor 4; 5 HT4; 5-HT4; 5-HT-4; 5 HT4 receptor; 5-HT4 receptor; 5-HT4 receptor (two splicing variants L and S); 5-HT4R; 5 HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5-hydroxytryptamine receptor 4; cardiac 5-HT4 receptor; Htr4; Serotonin receptor 4
• Common Name: HTR4
• Gene Symbol: HTR4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining