missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200427

Invitrogen™ Human HTR1F (aa 208-277) Control Fragment Recombinant Protein

Product Code. 30200427
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200427

Brand: Invitrogen™ RP88608

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

5-HT1F is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. 5-HT1F is a member of the GPCR family. Expression of 5-HT1F has been reported in various brain structures, including cortex, hippocampus, trigeminal ganglia, and cerebral blood vessels. Expression in peripheral tissues is limited to uterus, mesentery, and artery. No expression has been detected in heart, kidney, liver, pancreas, or spleen.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P30939
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3355
Name Human HTR1F (aa 208-277) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5-HT-1 E-beta; 5 ht1f; 5-HT1F; 5-HT-1 F; 5 HT1F Receptor; 5-HT1f receptor; 5 HT6; 5-hydroxytryptamine (serotonin) receptor 1 E beta; 5-hydroxytryptamine (serotonin) receptor 1 F; 5-hydroxytryptamine (serotonin) receptor 1 F, G protein-coupled; 5-hydroxytryptamine receptor 1 F; Htr1eb; HTR1EL; HTR1F; MR77; Serotonin receptor 1 F; serotonin receptor gene (similar to Mm Htr1eb)
Common Name HTR1F
Gene Symbol HTR1F
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.