Invitrogen™ Human HTR1A (aa 233-338) Control Fragment Recombinant Protein

Product Code. 30211819

Brand: Invitrogen™ RP90887

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53716 (PA5-53716. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.

Specifications

• Accession Number: P08908
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3350
• Name: Human HTR1A (aa 233-338) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5 HT1A; 5-HT1A; 5-HT-1 A; 5-HT1a receptor; 5-hydroxytryptamine (serotonin) receptor 1 A; 5-hydroxytryptamine (serotonin) receptor 1 A, G protein-coupled; 5-hydroxytryptamine receptor 1 A; ADRB2RL1; ADRBRL1; G-21; Gpcr18; G-protein coupled receptor 18; guanine nucleotide-binding regulatory protein-coupled receptor; HTR1A; PFMCD; RAT5HT1A; Serotonin receptor 1 A
• Common Name: HTR1A
• Gene Symbol: HTR1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining