missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HSPE1 (aa 3-65) Control Fragment Recombinant Protein

Product Code. 30180787
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180787

Brand: Invitrogen™ RP98822

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The heat shock proteins (HSPs) comprise a group of highly conserved, abundantly expressed proteins with diverse functions, including the assembly and sequestering of multiprotein complexes, transportation of nascent polypeptide chains across cellular membranes and regulation of protein folding. Heat shock proteins (also known as molecular chaperones) fall into six general families: HSP 90, HSP 70, HSP 60, the low molecular weight HSPs, the immunophilins and the HSP 110 family. The low molecular weight family includes HSP 10, HSP 20, HSP 27 (Heme Oxygenase 1), HSP 32 and HSP 40. Chaperonins are ubiquitous, indispensable proteins that facilitate protein folding in an ATP-dependent manner, enhancing the yield of properly folded substrate protein under conditions where spontaneous folding does not occur. Chaperonins are typified by the E. coli heat-shock proteins GroEL and GroES (HSP 10). HSP 10 is a heptameric ring of identical 10 kDa subunits that binds to each end of GroEL to form a symmetric, functional heterodimer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P61604
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3336
Name Human HSPE1 (aa 3-65) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 10 kDa chaperonin; 10 kDa heat shock protein, mitochondrial; 10 kDa heat shock protein, mitochondrial; MOB-like protein phocein; 10 kDa; 10 kDa Chaperonin; CH10; chaperonin 10; Cpn 10; CPN10; cpn10 protein; early pregnancy factor; early-pregnancy factor; EPF; GROES; Heat shock 10 kD protein 1 (chaperonin 10); heat shock 10 kDa protein 1 (chaperonin 10); heat shock 10 protein 1; heat shock 105 kDa/110 kDa protein 1; heat shock 10 kD protein; heat shock 10 kD protein 1 (chaperonin 10); heat shock 10 kDa protein 1; heat shock 10 kDa protein 1 (chaperonin 10); heat shock protein; heat shock protein 1 (chaperonin 10); heat shock protein 105; heat shock protein 105 kDa; heat shock protein 105 kDa; LOW QUALITY PROTEIN: heat shock protein 105 kDa; heat shock protein family E (Hsp10) member 1; heat shock protein family E (Hsp10) member 1 L homeolog; heat shock protein family H (Hsp110) member 1; HSP; hsp10; hsp105; hsp105a; hsp105b; hsp110; Hspe1; hspe1.L; Hsph1; hsph1-a; hsph1-b; mitochondrial 10 kDa heat shock protein; mitochondrial chaperonin 10; MOB family member 4, phocein; MOB1, Mps One Binder kinase activator-like 3; MOB4; MOBKL3; mob-like protein phocein; mt-cpn10; PREI3; preimplantation protein 3; XELAEV_18045050mg; zgc:86747
Common Name HSPE1
Gene Symbol HSPE1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.