Invitrogen™ Human HSPBP1 (aa 245-347) Control Fragment Recombinant Protein

Product Code. 30209691

Brand: Invitrogen™ RP103930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64461 (PA5-64461. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HspBP1 is an Hsp70-interacting protein that was first isolated from a human heart cDNA library using the yeast two-hybrid system. The ATPase domain of Hsp70 binds HspBP1 and upon binding, inhibits Hsp70 chaperone activity. More recently HspBP1 was found to promote nucleotide dissociation from Hsc70 (3) and is capable of altering the confirmation of the Hsp70 ATPase domain. HspBP1 is capable of regulating any Hsp70 activity that requires ATPase.

Specifications

• Accession Number: Q9NZL4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23640
• Name: Human HSPBP1 (aa 245-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500019G21Rik; FES1; Heat shock protein; heat shock protein-binding protein 1; HSP; hsp70 interacting protein; hsp70-binding protein 1; Hsp70-binding protein 2; hsp70-interacting protein; hsp70-interacting protein 1; Hsp70-interacting protein 2; HSPA (heat shock 70 kDa) binding protein, cytoplasmic cochaperone 1; HSPA (Hsp70) binding protein 1; HSPA binding protein, cytoplasmic cochaperone 1; Hspbp; HSPBP1; HspBP2; LOW QUALITY PROTEIN: hsp70-binding protein 1; MGC128574 protein; PP1845; SPA) binding protein, cytoplasmic cochaperone 1
• Common Name: HSPBP1
• Gene Symbol: HSPBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining