Invitrogen™ Human HSPA4 (aa 699-808) Control Fragment Recombinant Protein

Product Code. 30199500

Brand: Invitrogen™ RP89935

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82390 (PA5-82390. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The HSP 70 family is composed of four highly conserved proteins: HSP 70, HSC 70, GRP 75 and GRP 78. HSP 70 expression is strongly induced in response to heat stress. HSP 70 and HSC 70 play key roles in the cytosolic endoplasmic reticulum and mitochondrial import machinery and are found in both the cytosol and nucleus of mammalian cells. GRP 78 is localized in the endoplasmic reticulum, where it receives imported secretory proteins and is involved in the folding and translocation of nascent peptide chains. GRP 75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. It has been postulated that members of the HSP 70 family act as force-generating motors, relying on the hydrolysis of ATP for their activity.

Specifications

• Accession Number: P34932
• Concentration: 1.9 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3308
• Name: Human HSPA4 (aa 699-808) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 70 kDa; AI317151; APG2; APG-2; epididymis secretory sperm binding protein Li 5 A; heat shock 70 kDa protein 4; heat shock 70 kD protein 4; heat shock 70 kDa protein 4; Heat shock 70-related protein APG-2; Heat shock protein; heat shock protein 4; heat shock protein Apg-2; heat shock protein family A (Hsp70) member 4; heat shock protein, 110 kDa; HEL-S-5 A; HS24/P52; Hsp110; hsp70; hsp70 RY; Hsp70RY; Hspa4; HSPH2; Irp94; ischemia responsive 94 kDa protein; mKIAA4025; RY
• Common Name: HSPA4
• Gene Symbol: HSPA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining