Invitrogen™ Human HSPA2 (aa 488-637) Control Fragment Recombinant Protein

Product Code. 30209167

Brand: Invitrogen™ RP88859

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81895 (PA5-81895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Specifications

• Accession Number: P54652
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3306
• Name: Human HSPA2 (aa 488-637) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 70 kDa heat shock protein; 70 kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70 kD protein 2; heat shock 70 kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
• Common Name: HSPA2
• Gene Symbol: HSPA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining