Invitrogen™ Human HSPA12B (aa 257-319) Control Fragment Recombinant Protein

Product Code. 30210365

Brand: Invitrogen™ RP90758

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53076 (PA5-53076. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Specifications

• Accession Number: Q96MM6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116835
• Name: Human HSPA12B (aa 257-319) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700081N06Rik; C20orf60; Heat shock 70 kDa protein 12 B; Heat shock protein; heat shock protein 12 B; heat shock protein 70 kDa 12 B; heat shock protein family A (Hsp70) member 12 B; HSP; HSPA12B
• Common Name: HSPA12B
• Gene Symbol: HSPA12B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining