Invitrogen™ Human HSPA12A (aa 554-671) Control Fragment Recombinant Protein

Produktkod. 30193616

Brand: Invitrogen™ RP89932

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52810 (PA5-52810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSPA12A is a protein coding gene.

Specifikationer

• Accession Number: O43301
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 259217
• Name: Human HSPA12A (aa 554-671) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700063D12Rik; AI118035; AI840429; AW048913; AW556406; D5Mgi40; heat shock 70 kDa protein 12 A; heat shock 70 kD protein 12 A; heat shock 70 kDa protein 12 A; Heat shock protein; heat shock protein 12 A; heat shock protein family A (Hsp70) member 12 A; HSP; HSPA12A; KIAA0417; mKIAA0417
• Common Name: HSPA12A
• Gene Symbol: HSPA12A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGID
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining