Invitrogen™ Human HSP60 (aa 196-330) Control Fragment Recombinant Protein

Product Code. 30211020

Brand: Invitrogen™ RP104888

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13.

Specifications

• Accession Number: P10809
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3329
• Name: Human HSP60 (aa 196-330) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 kDa chaperonin; 60 kDa heat shock protein; 60 kDa heat shock protein, mitochondrial; 60 kDa; Chaperonin 60; CPN60; GROEL; heat shock 60 kD protein 1 (chaperonin); heat shock 60 kDa protein 1; heat shock 60 kDa protein 1 (chaperonin); Heat shock protein; heat shock protein 1 (chaperonin); heat shock protein 60; heat shock protein 60 (liver); heat shock protein 65; heat shock protein family D (Hsp60) member 1; heat shock protein, 60 kDa; HLD4; HSP; Hsp60; HSP-60; Hsp60s1; HSP65; HSP-65; Hspd1; Hspd1-30 p; HuCHA60; hypothetical protein; I79_011398; mitochondrial matrix protein P1; P1 protein; P60 lymphocyte protein; RCJMB04_7g5; short heat shock protein 60 Hsp60s1; SPG13; Unknown (protein for IMAGE:7943409)
• Common Name: HSP60
• Gene Symbol: HSPD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining