missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HSP60 (aa 196-330) Control Fragment Recombinant Protein

Product Code. 30211020
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211020 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211020 Supplier Invitrogen™ Supplier No. RP104888

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10809
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3329
Name Human HSP60 (aa 196-330) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 60 kDa chaperonin; 60 kDa heat shock protein; 60 kDa heat shock protein, mitochondrial; 60 kDa; Chaperonin 60; CPN60; GROEL; heat shock 60 kD protein 1 (chaperonin); heat shock 60 kDa protein 1; heat shock 60 kDa protein 1 (chaperonin); Heat shock protein; heat shock protein 1 (chaperonin); heat shock protein 60; heat shock protein 60 (liver); heat shock protein 65; heat shock protein family D (Hsp60) member 1; heat shock protein, 60 kDa; HLD4; HSP; Hsp60; HSP-60; Hsp60s1; HSP65; HSP-65; Hspd1; Hspd1-30 p; HuCHA60; hypothetical protein; I79_011398; mitochondrial matrix protein P1; P1 protein; P60 lymphocyte protein; RCJMB04_7g5; short heat shock protein 60 Hsp60s1; SPG13; Unknown (protein for IMAGE:7943409)
Common Name HSP60
Gene Symbol HSPD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.