Invitrogen™ Human HSP27 (aa 40-155) Control Fragment Recombinant Protein

Product Code. 30199401

Brand: Invitrogen™ RP93675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In response to adverse changes in their environment, cells from many organisms increase the expression of a class of proteins referred to as heat shock or stress proteins. HSPB1 (heat shock protein beta-1 or HSP27) is a small heat shock protein which functions as a molecular chaperone that maintains denatured proteins in a folding-competent state. It plays a role in stress resistance and actin organization. Through its molecular chaperone activity, HSP27 regulates numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins. Mutations in the gene can result in Charcot-Marie-Tooth disease 2F and Neuronopathy distal hereditary motor 2B.

Specifications

• Accession Number: P04792
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3315
• Name: Human HSP27 (aa 40-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 27 kDa; 28 kDa heat shock protein; CMT2F; DKFZp586P1322; epididymis secretory protein Li 102; estrogen-regulated 24 kDa protein; Growth-related 25 kDa protein; heat shock 25 kDa protein; Heat shock 27 kDa protein; heat shock 27 kD protein 1; heat shock 27 kDa protein 1; Heat shock protein; heat shock protein 1; heat shock protein 27 kDa beta-1; heat shock protein B1; heat shock protein beta-1; heat shock protein family B (small) member 1; heat shock protein, 25 kDa; heat-shock protein; HEL-S-102; HMN2B; HS; HS0.7607; HSP; HSP 25; HSP 27; Hsp25; HSP27; HSP28; HSPB1; p25; Phospho-HSP 27; SRP27; Stress-responsive protein 27; truncated hsp25
• Common Name: HSP27
• Gene Symbol: HSPB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining