missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HSP27 (aa 40-155) Control Fragment Recombinant Protein

Product Code. 30199401
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199401

Brand: Invitrogen™ RP93675

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In response to adverse changes in their environment, cells from many organisms increase the expression of a class of proteins referred to as heat shock or stress proteins. HSPB1 (heat shock protein beta-1 or HSP27) is a small heat shock protein which functions as a molecular chaperone that maintains denatured proteins in a folding-competent state. It plays a role in stress resistance and actin organization. Through its molecular chaperone activity, HSP27 regulates numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins. Mutations in the gene can result in Charcot-Marie-Tooth disease 2F and Neuronopathy distal hereditary motor 2B.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P04792
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3315
Name Human HSP27 (aa 40-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 27 kDa; 28 kDa heat shock protein; CMT2F; DKFZp586P1322; epididymis secretory protein Li 102; estrogen-regulated 24 kDa protein; Growth-related 25 kDa protein; heat shock 25 kDa protein; Heat shock 27 kDa protein; heat shock 27 kD protein 1; heat shock 27 kDa protein 1; Heat shock protein; heat shock protein 1; heat shock protein 27 kDa beta-1; heat shock protein B1; heat shock protein beta-1; heat shock protein family B (small) member 1; heat shock protein, 25 kDa; heat-shock protein; HEL-S-102; HMN2B; HS; HS0.7607; HSP; HSP 25; HSP 27; Hsp25; HSP27; HSP28; HSPB1; p25; Phospho-HSP 27; SRP27; Stress-responsive protein 27; truncated hsp25
Common Name HSP27
Gene Symbol HSPB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.