Invitrogen™ Human HSFX1 (aa 8-110) Control Fragment Recombinant Protein

Product Code. 30203456

Brand: Invitrogen™ RP108482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84581 (PA5-84581. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSFX1 (Heat Shock Transcription Factor Family, X-Linked 1) is a Protein Coding gene. Diseases associated with HSFX1 include Microsporidiosis. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and sequence-specific DNA binding. An important paralog of this gene is HSFX2. [GeneCards]

Specifications

• Accession Number: Q9UBD0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100506164
• Name: Human HSFX1 (aa 8-110) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: heat shock transcription factor family, x linked 1; heat shock transcription factor family, X-linked 1; heat shock transcription factor, X-linked; HSFX1; HSFX2; LW-1; ORC4L; testicular secretory protein Li 21
• Common Name: HSFX1
• Gene Symbol: HSFX1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining