Invitrogen™ Human HSF4 (aa 335-441) Control Fragment Recombinant Protein

Product Code. 30202806

Brand: Invitrogen™ RP104858

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65521 (PA5-65521. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.

Specifications

• Accession Number: Q9ULV5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3299
• Name: Human HSF4 (aa 335-441) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATHSF4; AT-HSFB1; binds heat shock DNA elements; cataract; CTM; CTRCT5; DNA binding protein; heat shock factor 4; heat shock factor protein 4; Heat shock transcription factor 4; hHSF4; HSF 4; Hsf4; HSFB1; HSTF 4; HSTF4; ldis1; Marner; mHSF4
• Common Name: HSF4
• Gene Symbol: HSF4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKGSFSPEGPRNAQQPEPGDPREIPDRGPLGLESGDRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining