Invitrogen™ Human HSF2BP (aa 91-161) Control Fragment Recombinant Protein

Product Code. 30212617

Brand: Invitrogen™ RP95893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111028 (PA5-111028, PA5-140277 (PA5-140277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.

Specifications

• Accession Number: O75031
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11077
• Name: Human HSF2BP (aa 91-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932437G14Rik; heat shock factor 2-binding protein; heat shock transcription factor 2 binding protein; Hsf2bp; RGD1565879
• Common Name: HSF2BP
• Gene Symbol: HSF2BP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining