missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180931

Invitrogen™ Human HSD17B8 (aa 165-247) Control Fragment Recombinant Protein

Product Code. 30180931
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180931

Brand: Invitrogen™ RP99282

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59882 (PA5-59882. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3- ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92506
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7923
Name Human HSD17B8 (aa 165-247) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 17-beta-HSD 8; 17-beta-hydroxysteroid dehydrogenase 8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; D17H6S112E; D6S2245E; dJ1033B10.9; Estradiol 17-beta-dehydrogenase 8; estrogen 17-oxidoreductase; FABG; FABGL; H FABGL; H2-K region expressed gene 6; H-2 Ke6; H2-KE6; Hke6; Hsd17b8; hydroxysteroid (17-beta) dehydrogenase 8; hydroxysteroid 17-beta dehydrogenase 8; KAR alpha subunit; KE6; Ke-6; Protein Ke6; really interesting new gene 2 protein; RING2; SDR30C1; Short chain dehydrogenase/reductase family 30 C member 1; short chain dehydrogenase/reductase family 30 C, member 1; Testosterone 17-beta-dehydrogenase 8
Common Name HSD17B8
Gene Symbol HSD17B8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.