missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204736

Invitrogen™ Human HSD17B4 (aa 97-222) Control Fragment Recombinant Protein

Product Code. 30204736
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204736

Brand: Invitrogen™ RP93145

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110873 (PA5-110873. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxisomal multifunctional enzyme type 2 is a protein that in humans is encoded by the HSD17B4 gene. The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidation activity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present on chromosome 8. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51659
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3295
Name Human HSD17B4 (aa 97-222) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (3 R)-hydroxyacyl-CoA dehydrogenase; 17 [b]-HSD; 17 beta-estradiol dehydrogenase type IV; 17-beta-HSD; 17-beta-HSD 4; 17-beta-HSD IV; 17-beta-hydroxysteroid dehydrogenase 4; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase; 4; beta-hydroxyacyl dehydrogenase; beta-keto-reductase; D-3-hydroxyacyl-CoA dehydratase; D-bifunctional protein; D-bifunctional protein, peroxisomal; DBP; Edh17b4; Enoyl-CoA hydratase 2; Hsd17b4; hydroxysteroid (17-beta) dehydrogenase 4; hydroxysteroid 17-beta dehydrogenase 4; hydroxysteroid dehydrogenase 4; MFE-2; MFP2; Mfp-2; MPF-2; Multifunctional protein 2; perMFE-2; peroxisomal multifunctional enzyme type 2; peroxisomal multifunctional enzyme type II; peroxisomal multifunctional protein 2; PRLTS1; SDR8C1; Short chain dehydrogenase/reductase family 8 C member 1; short chain dehydrogenase/reductase family 8 C, member 1
Common Name HSD17B4
Gene Symbol HSD17B4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.