missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HSD11B1 (aa 213-290) Control Fragment Recombinant Protein

Product Code. 30211747
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211747 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211747 Supplier Invitrogen™ Supplier No. RP100922

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83877 (PA5-83877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P28845
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3290
Name Human HSD11B1 (aa 213-290) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 11 beta-hydroxysteroid dehydrogenase type 1; 11 beta-HSD type 1; 11-beta-HSD1; 11 beta-HSD1; 11 beta-HSD-1; 11 beta-HSD1A; 11-beta-hydroxysteroid dehydrogenase; 11-beta-hydroxysteroid dehydrogenase 1; 11-beta-hydroxysteroid dehydrogenase type 1; 11 beta-hydroxysteroid dehydrogenase type 1; 11-DH; Corticosteroid 11-beta-dehydrogenase isozyme 1; Corticosteroid 11-beta-dehydrogenase, isozyme 1 (11-DH) (11-beta-hydroxysteroid dehydrogenase 1) (11-beta-HSD1) (11 beta-HSD1A); cortocosteroid 11-beta dehydrogenase; CORTRD2; HDL; HSD11; HSD11B; Hsd11b1; HSD11L; hydroxysteroid (11-beta) dehydrogenase 1; hydroxysteroid 11-beta dehydrogenase 1; hydroxysteroid dehydrogenase, 11 beta type 1; LRRGT00065; MGC13539; OTTHUMP00000034650; SDR26C1; short chain dehydrogenase/reductase family 26 C member 1; short chain dehydrogenase/reductase family 26 C, member 1; short-chain reductase; short-chain reductase/dehydrogenase
Common Name HSD11B1
Gene Symbol Hsd11b1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.