Invitrogen™ Human HSD11B1 (aa 213-290) Control Fragment Recombinant Protein

Product Code. 30211747

Brand: Invitrogen™ RP100922

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83877 (PA5-83877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P28845
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3290
• Name: Human HSD11B1 (aa 213-290) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 11 beta-hydroxysteroid dehydrogenase type 1; 11 beta-HSD type 1; 11-beta-HSD1; 11 beta-HSD1; 11 beta-HSD-1; 11 beta-HSD1A; 11-beta-hydroxysteroid dehydrogenase; 11-beta-hydroxysteroid dehydrogenase 1; 11-beta-hydroxysteroid dehydrogenase type 1; 11 beta-hydroxysteroid dehydrogenase type 1; 11-DH; Corticosteroid 11-beta-dehydrogenase isozyme 1; Corticosteroid 11-beta-dehydrogenase, isozyme 1 (11-DH) (11-beta-hydroxysteroid dehydrogenase 1) (11-beta-HSD1) (11 beta-HSD1A); cortocosteroid 11-beta dehydrogenase; CORTRD2; HDL; HSD11; HSD11B; Hsd11b1; HSD11L; hydroxysteroid (11-beta) dehydrogenase 1; hydroxysteroid 11-beta dehydrogenase 1; hydroxysteroid dehydrogenase, 11 beta type 1; LRRGT00065; MGC13539; OTTHUMP00000034650; SDR26C1; short chain dehydrogenase/reductase family 26 C member 1; short chain dehydrogenase/reductase family 26 C, member 1; short-chain reductase; short-chain reductase/dehydrogenase
• Common Name: HSD11B1
• Gene Symbol: Hsd11b1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining